PDB entry 2xjk

View 2xjk on RCSB PDB site
Description: Monomeric Human Cu,Zn Superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, metal-binding, protein folding, neurodegeneration
Deposited on 2010-07-07, released 2010-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (5)
      • engineered mutation (49-50)
      • engineered mutation (110)
    Domains in SCOPe 2.08: d2xjka_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xjkA (A:)
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq