PDB entry 2xj3

View 2xj3 on RCSB PDB site
Description: High resolution structure of the T55C mutant of CylR2.
Class: DNA binding protein
Keywords: DNA binding protein, hth-DNA binding motif, transcription regulator
Deposited on 2010-07-02, released 2011-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cylr2 synonym cytolysin repressor 2
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VL32 (0-65)
      • engineered mutation (54)
    Domains in SCOPe 2.08: d2xj3a_
  • Chain 'B':
    Compound: cylr2 synonym cytolysin repressor 2
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VL32 (0-65)
      • engineered mutation (54)
    Domains in SCOPe 2.08: d2xj3b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xj3A (A:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xj3B (B:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe