PDB entry 2xiz

View 2xiz on RCSB PDB site
Description: protein kinase pim-1 in complex with fragment-3 from crystallographic fragment screen
Class: transferase
Keywords: phosphorylation, transferase
Deposited on 2010-07-01, released 2011-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.25797
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene serine/threonine protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xiza_
  • Heterogens: XIZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xizA (A:)
    gaapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekd
    risdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdf
    itergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgal
    lkdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgq
    vffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgps
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xizA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs