PDB entry 2xiw

View 2xiw on RCSB PDB site
Description: Crystal structure of the Sac7d-derived IgG1-binder C3-C24S
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2010-07-01, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein 7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (12-End)
      • engineered mutation (17-19)
      • engineered mutation (31-32)
      • engineered mutation (34)
      • engineered mutation (36)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (45)
      • engineered mutation (50)
      • engineered mutation (52)
      • engineered mutation (54)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d2xiwa_
  • Chain 'B':
    Compound: DNA-binding protein 7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (12-76)
      • expression tag (77-78)
      • engineered mutation (17-19)
      • engineered mutation (31-32)
      • engineered mutation (34)
      • engineered mutation (36)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (43)
      • engineered mutation (45)
      • engineered mutation (50)
      • engineered mutation (52)
      • engineered mutation (54)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d2xiwb1, d2xiwb2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xiwA (A:)
    mrgshhhhhhgsvkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekd
    apkelldmlaraerekkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xiwA (A:)
    vkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekdapkelldmlara
    erek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xiwB (B:)
    mrgshhhhhhgsvkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekd
    apkelldmlaraerekkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xiwB (B:)
    vkvkfllngeekevdtskirdvsrqgknvkflyndngkygagnvdekdapkelldmlara
    erekkln