PDB entry 2xiu

View 2xiu on RCSB PDB site
Description: high resolution structure of mtsl-tagged cylr2.
Class: DNA binding protein
Keywords: DNA binding protein, hth-DNA binding motif
Deposited on 2010-07-01, released 2011-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1471
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cylr2
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VL32 (0-65)
      • engineered mutation (54)
    Domains in SCOPe 2.05: d2xiua_
  • Chain 'B':
    Compound: cylr2
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VL32 (0-End)
      • engineered mutation (54)
    Domains in SCOPe 2.05: d2xiub_
  • Heterogens: MTN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xiuA (A:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2xiuB (B:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqpe

    Sequence, based on observed residues (ATOM records): (download) 
    >2xiuB (B:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylncpledi
fqwqp