PDB entry 2xil

View 2xil on RCSB PDB site
Description: The structure of cytochrome c peroxidase Compound I
Class: oxidoreductase
Keywords: oxidoreductase, compound III, apx, ascorbate peroxidase, ferryl ion, ferrous heme
Deposited on 2010-06-30, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (3-293)
      • expression tag (1-2)
      • conflict (209)
    Domains in SCOPe 2.08: d2xila1, d2xila2
  • Heterogens: MPD, MRD, HEM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xilA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnenwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xilA (A:)
    ktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnenwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl