PDB entry 2xi8

View 2xi8 on RCSB PDB site
Description: High resolution structure of native CylR2
Class: transcription
Keywords: transcription, hth DNA-binding motif
Deposited on 2010-06-28, released 2011-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative transcription regulator
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xi8a_
  • Chain 'B':
    Compound: putative transcription regulator
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xi8b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xi8A (A:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xi8B (B:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe