PDB entry 2xhq

View 2xhq on RCSB PDB site
Description: Crystal structure of Archaemetzincin (AmzA) from Archaeoglobus fulgidus at 1.45 A resolution
Deposited on 2010-06-18, released 2011-07-06
The last revision was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.1688
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: archaemetzincin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29917 (3-162)
      • expression tag (0-2)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xhqA (A:)
gshmkiyiqplsvnshtvevlanslpkifnaevfvlpasdvslkcynasrrqynstcilr
mlppikvtlgvtgkdiyakgmnfvfgeaelggaravlsvfrlttadselyrervvkeavh
eighvlglkhcsnncvmrfsnsvqdvdrkpvsfcrecaskiry