PDB entry 2xhh

View 2xhh on RCSB PDB site
Description: circular permutation provides an evolutionary link between two families of calcium-dependent carbohydrate binding modules
Deposited on 2010-06-16, released 2010-07-21
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate binding module
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XHH (111-118)
  • Heterogens: LMR, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xhhA (A:)
    snsitvrargvngqesvslqvggttvqtwtlttamqdytastsltgeirvaftndatgrd
    vqvdyivvngqtrqaenqsvntgvwannqcggsgnsewlhcngyisfgnvslehhhhhh