PDB entry 2xh5

View 2xh5 on RCSB PDB site
Description: structure of 4-(4-tert-butylbenzyl)-1-(7h-pyrrolo(2,3-d) pyrimidin-4-yl)piperidin-4-amine bound to pkb
Class: transferase
Keywords: serine/threonine-protein kinase, nucleotide-binding, wnt signaling pathway, kinase, transferase, phosphoprotein
Deposited on 2010-06-09, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.21574
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (5-341)
      • engineered mutation (329-331)
      • engineered mutation (333-334)
      • engineered mutation (336)
      • engineered mutation (338)
      • engineered mutation (340-341)
    Domains in SCOPe 2.07: d2xh5a_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: X37, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xh5A (A:)
    gamdpkvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvte
    srvlqntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeiv
    saleylhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksl
    lagllkkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfd
    deftaqsititppdrydslglleldqreeqemfedfdyiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh5A (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsitqemfedfdyiadw
    

  • Chain 'C':
    No sequence available.