PDB entry 2xh1

View 2xh1 on RCSB PDB site
Description: crystal structure of human kat II-inhibitor complex
Class: transferase
Keywords: transferase, covalent inhibition
Deposited on 2010-06-08, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18929
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5Z0 (0-424)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2xh1a_
  • Chain 'B':
    Compound: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5Z0 (0-424)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2xh1b_
  • Heterogens: BF5, PLP, IOD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xh1A (A:)
    enyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh1A (A:)
    enyarfitaasaarnpspimislagglpnpnmfpfktavitvengktiqfgeemmkralq
    yspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqglckvfemiinpgd
    nvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkpedaknpqkntpkf
    lytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnkfrvptflsmdvdg
    rviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnqlmisqllhewgee
    gfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikvkgindvkelieek
    avkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaqlikesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xh1B (B:)
    enyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
    iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
    lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
    edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnk
    frvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
    lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
    kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
    ikesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xh1B (B:)
    enyarfitaasaarnpspimislagglpnpnmfpfktavitvengktiqfgeemmkralq
    yspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqglckvfemiinpgd
    nvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkpedaknpqkntpkf
    lytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfnkfrvptflsmdvdg
    rviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnqlmisqllhewgee
    gfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikvkgindvkelieek
    avkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaqlikesl