PDB entry 2xgu

View 2xgu on RCSB PDB site
Description: structure of the n-terminal domain of capsid protein from rabbit endogenous lentivirus (relik)
Deposited on 2010-06-07, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.1963
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: relik capsid n-terminal domain
    Species: ORYCTOLAGUS CUNICULUS, synthetic [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XGU (0-End)
  • Chain 'B':
    Compound: relik capsid n-terminal domain
    Species: ORYCTOLAGUS CUNICULUS, synthetic [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XGU (0-End)
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xguA (A:)
    pimlrggrqeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtp
    gfaaekqlvidkikekaiawdemhppppadaagpvpltsdqirgiglspeeaagprfada
    rtlyrtwvlealqecqrtisplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2xguA (A:)
    pimlrggrqeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtp
    gfaaekqlvidkikekaiawdemhppppadaagpvpltsdqirgiglspeeaagprfada
    rtlyrtwvlealqecqrtisple
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xguB (B:)
    pimlrggrqeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtp
    gfaaekqlvidkikekaiawdemhppppadaagpvpltsdqirgiglspeeaagprfada
    rtlyrtwvlealqecqrtisplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2xguB (B:)
    pimlrggrqeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtp
    aekqlvidkikekaiawdemhppppaaagpvpltsdqirgiglspeeaagprfadartly
    rtwvlealqecqrt