PDB entry 2xg3

View 2xg3 on RCSB PDB site
Description: human galectin-3 in complex with a benzamido-n-acetyllactoseamine inhibitor
Deposited on 2010-05-30, released 2010-10-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-137)
      • expression tag (0)
  • Heterogens: CL, UNU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xg3A (A:)
    alivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
    cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
    klgisgdidltsasytmi