PDB entry 2xfx

View 2xfx on RCSB PDB site
Description: cattle MHC class I N01301 presenting an 11mer from Theileria parva
Class: immune system
Keywords: immune system, major histocompatibility, east coast fever, theileriosis
Deposited on 2010-05-28, released 2010-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1998
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class 1
    Species: BOS TAURUS [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q30291 (0-275)
      • expression tag (276)
    Domains in SCOPe 2.08: d2xfxa1, d2xfxa2, d2xfxa3
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: BOS TAURUS [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xfxb_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: THEILERIA PARVA [TaxId:5875]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xfxA (A:)
    gshslryfhtavsrpglreplfitvgyvddtqfvrfdsdardprteprqpwmekegpeyw
    dretqiskenalwyrealnnlrgyynqseagshtlqemygcdvgsdgrlrrgyeqygydg
    rdylalnedlrswtaadtaaqiskrkmeaagaaerfrnylegtcvewlrrylengkdtll
    radppkahvtrhpssehevtlrcwalgfypeeisltwqrngedqtqdmelvetrpsgdgn
    fqkwaalvvpsgeeqrytcrvqheglqepltlrwepg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xfxB (B:)
    aiqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdw
    sfyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

  • Chain 'C':
    No sequence available.