PDB entry 2xfr

View 2xfr on RCSB PDB site
Description: Crystal structure of barley beta-amylase at atomic resolution
Class: hydrolase
Keywords: hydrolase, carbohydrate metabolism, glycosyl hydrolase family 14, starch degradation, germination
Deposited on 2010-05-28, released 2010-12-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.114
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16098
      • see remark 999 (164)
      • see remark 999 (346)
      • see remark 999 (429)
    Domains in SCOPe 2.04: d2xfra_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xfrA (A:)
    mevnvkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegk
    gpkaydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdif
    ytdghgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglg
    pagemrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtp
    ertqffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihww
    ykvpshaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeel
    vqqvlsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrls
    nqlvegqnyanfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpf
    qehtdlpvgptggmggqaegptcgmggqvkgptggmggqaedptsgiggelpatm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xfrA (A:)
    vnvkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgp
    kaydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifyt
    dghgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglgpa
    gemrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtper
    tqffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihwwyk
    vpshaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeelvq
    qvlsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrlsnq
    lvegqnyanfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpfqe
    htdlpvg