PDB entry 2xfm

View 2xfm on RCSB PDB site
Description: complex structure of the miwi paz domain bound to methylated single stranded rna
Deposited on 2010-05-27, released 2011-01-26
The last revision was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Piwi-like protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5'-r(*ap*cp*cp*gp*ap*cp*up*(omu)p)-3'
    Species: synthetic, synthetic

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xfmA (A:)
    rsetvldfmfnlyqqteehkfqeqvskeliglivltkynnktyrvddidwdqnpkstfkk
    adgsevsfleyyrkqynqeitdlkqpvlvsqpkrrrgpggtlpgpamlipelcyltgltd
    kmrndfnvmkdlavhtrltpeqrqrevgrl
    

    Sequence, based on observed residues (ATOM records):
    >2xfmA (A:)
    rsetvldfmfnlyqqteehkfqeqvskeliglivltkynnktyrvddidwdqnpkstfkk
    adgsevsfleyyrkqynqeitdlkqpvlvsqpkrrrgpggtlpgpamlipelcyltgltd
    

  • Chain 'B':
    No sequence available.