PDB entry 2xfh

View 2xfh on RCSB PDB site
Description: structure of cytochrome p450 eryk cocrystallized with inhibitor clotrimazole.
Class: oxidoreductase
Keywords: monoxygenase, erythromycin a biosynthesis, oxidoreductase
Deposited on 2010-05-24, released 2010-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18358
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythromycin b/d c-12 hydroxylase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48635 (Start-410)
      • engineered mutation (343)
    Domains in SCOPe 2.03: d2xfha_
  • Heterogens: HEM, CL6, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xfhA (A:)
    mfadvettccarrtlttidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvq
    tvlrdtatfssdptrviegasptpgmiheidppehralrkvvssaftprtisdleprird
    vtrslladagesfdlvdvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdp
    alaeriadvlnpltaylkarcaerradpgddlisrlvlaevdgralddeeaanfstalll
    aghitttvllgnivrtldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkate
    vagvpipadvmvntwvlsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplar
    lenrvaleeiiarfgrltvdrdderlrhfeqivlgtrhlpvlagssprqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xfhA (A:)
    idevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrvi
    egasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvd
    vlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltayl
    karcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtl
    dehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvl
    sanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrl
    tvdrdderlrhfeqivlgtrhlpvlagssprqsa