PDB entry 2xfg

View 2xfg on RCSB PDB site
Description: reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Class: hydrolase/sugar binding protein
Keywords: hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein
Deposited on 2010-05-24, released 2011-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.1432
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase 1
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02934 (Start-463)
      • expression tag (464-465)
      • conflict (46)
    Domains in SCOPe 2.05: d2xfga_
  • Chain 'B':
    Compound: endoglucanase 1
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02934 (1-167)
      • expression tag (168-172)
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xfgA (A:)
    menknggylpeeeipdqppatgafnygealqkaiffyecqrsgkldsstlrlnwrgdsgl
    ddgkdagidltggwydagdhvkfnlpmsysaamlgwavyeyedafkqsgqynhilnnikw
    acdyfikchpekdvyyyqvgdghadhawwgpaevmpmerpsykvdrsspgstvvaetsaa
    laiasiifkkvdgeyskeclkhakelfefadttksddgytaangfynswsgfydelswaa
    vwlylatndssyldkaesysdkwgyepqtnipkykwaqcwddvtygtylllarikndngk
    ykeaierhldwwttgyngeritytpkglawldqwgslryatttaflacvysdwengdkek
    aktylefarsqadyalgstgrsfvvgfgenppkrphhrtahgswadsqmeppehrhvlyg
    alvggpdstdnytddisnytcnevacdynagfvgllakmyklygel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xfgA (A:)
    tgafnygealqkaiffyecqrsgkldsstlrlnwrgdsglddgkdagidltggwydagdh
    vkfnlpmsysaamlgwavyeyedafkqsgqynhilnnikwacdyfikchpekdvyyyqvg
    dghadhawwgpaevmpmerpsykvdrsspgstvvaetsaalaiasiifkkvdgeyskecl
    khakelfefadttksddgytaangfynswsgfydelswaavwlylatndssyldkaesys
    dkwgyepqtnipkykwaqcwddvtygtylllarikndngkykeaierhldwwttgynger
    itytpkglawldqwgslryatttaflacvysdwengdkekaktylefarsqadyalgstg
    rsfvvgfgenppkrphhrtahgswadsqmeppehrhvlygalvggpdstdnytddisnyt
    cnevacdynagfvgllakmyklygel
    

  • Chain 'B':
    No sequence available.