PDB entry 2xfd

View 2xfd on RCSB PDB site
Description: vcbm60 in complex with cellobiose
Deposited on 2010-05-21, released 2010-06-16
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate binding module
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xfdA (A:)
msnsitvrargvngqesvslqvggttvqtwtlttamqdytastsltgeirvaftndatgr
dvqvdyivvngqtrqaenqsvntgvwannqcggsgnsewlhcngyisfgnvs

    Sequence, based on observed residues (ATOM records):
    >2xfdA (A:)
nsitvrargvngqesvslqvggttvqtwtlttamqdytastsltgeirvaftndatgrdv
qvdyivvngqtrqaenqsvntgvwannqcggsgnsewlhcngyisfgnv