PDB entry 2xf6

View 2xf6 on RCSB PDB site
Description: crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Deposited on 2010-05-20, released 2010-08-11
The last revision was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.2056
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xf6A (A:)
msesllygyfldswldgtaseellrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf6A (A:)
sesllygyfldswldgtaseellrvavnagdltqeeadkimsypwgawnd