PDB entry 2xf5

View 2xf5 on RCSB PDB site
Description: crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Deposited on 2010-05-20, released 2010-08-11
The last revision was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468 (1-End)
      • engineered mutation (22-23)
  • Chain 'B':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468 (1-50)
      • engineered mutation (22-23)
  • Chain 'C':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468 (1-End)
      • engineered mutation (22-23)
  • Chain 'D':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468
      • engineered mutation (22-23)
  • Chain 'E':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468 (1-End)
      • engineered mutation (22-23)
  • Chain 'F':
    Compound: gp23.1
    Species: Bacillus phage SPP1 [TaxId:10724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48468 (1-End)
      • engineered mutation (22-23)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xf5A (A:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5A (A:)
sesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xf5B (B:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5B (B:)
sesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2xf5C (C:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5C (C:)
sesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawn

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2xf5D (D:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5D (D:)
esllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawn

  • Chain 'E':
    Sequence, based on SEQRES records:
    >2xf5E (E:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5E (E:)
sesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawn

  • Chain 'F':
    Sequence, based on SEQRES records:
    >2xf5F (F:)
gsesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawnd

    Sequence, based on observed residues (ATOM records):
    >2xf5F (F:)
sesllygyfldswldgtaseemmrvavnagdltqeeadkimsypwgawn