PDB entry 2xf4

View 2xf4 on RCSB PDB site
Description: Crystal structure of Salmonella enterica serovar typhimurium YcbL
Deposited on 2010-05-20, released 2010-07-28
The last revision was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19471
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxyacylglutathione hydrolase
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xf4A (A:)
    mnyriipvtafsqncsliwceqtrlaalvdpggdaekikqevdasgvtlmqillthghld
    hvgaaselaqhygvpvigpekedefwlqglpaqsrmfgldecqpltpdrwlndgdrvsvg
    nvtlqvlhcpghtpghvvffdeqsqllisgdvifkggvgrsdfprgdhtqlidaikrkll
    plgddvtfipghgplstlgyerlhnpflqd