PDB entry 2xf3

View 2xf3 on RCSB PDB site
Description: structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Deposited on 2010-05-20, released 2011-06-29
The last revision was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf12
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: orf12
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: J01, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xf3A (A:)
    mmkkadsvptpaeaalaaqtalaaddspmgdaarwamglltssglprpedvaarfiptfa
    aagnfaetvrewrskgpftvrayhpvahkgwvvlsapagvryilsltldssgliriltlk
    petvipdmvtwndveetlhtpgvqhsvyavrltpdghevlhasaperpmptgsayklylm
    ralvaeiekgtvgwdeiltltpelrslptgdmqdlpdgtrvtvretahkmialsdntgad
    lvadrlgrevverslaaaghhdpslmrpfltshevfelgwgdperraewvrqdeagrrel
    lekmagvmtvrgsdlgatvhqlgidwhmdafdvvrvlegllqdsgrdtsgtveeiltayp
    gllideerwrrvyfkagsspgvmmfcwllqdhagisyvlvlrqsadeqrligdglflrgi
    gakiieaeakllssgerrgagtaaagddrasageaarr
    

    Sequence, based on observed residues (ATOM records):
    >2xf3A (A:)
    vptpaeaalaaqtalaaddspmgdaarwamglltssgedvaarfiptfaaagnfaetvre
    wrskgpftvrayhpvahkgwvvlsapagvryilsltldssgliriltlkpetvipdmvtw
    ndveetlhtpgvqhsvyavrltpdghevlhasaperpmptgsayklylmralvaeiekgt
    vgwdeiltltpelrslptgdmqdlpdgtrvtvretahkmialsdntgadlvadrlgrevv
    erslaaaghhdpslmrpfltshevfelgwgdperraewvrqdeagrrellekmagvmtvr
    gsdlgatvhqlgidwhmdafdvvrvlegllqdsgrdtsgtveeiltaypgllideerwrr
    vyfkagsspgvmmfcwllqdhagisyvlvlrqsadeqrligdglflrgigakiieaeakl
    lss
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xf3B (B:)
    mmkkadsvptpaeaalaaqtalaaddspmgdaarwamglltssglprpedvaarfiptfa
    aagnfaetvrewrskgpftvrayhpvahkgwvvlsapagvryilsltldssgliriltlk
    petvipdmvtwndveetlhtpgvqhsvyavrltpdghevlhasaperpmptgsayklylm
    ralvaeiekgtvgwdeiltltpelrslptgdmqdlpdgtrvtvretahkmialsdntgad
    lvadrlgrevverslaaaghhdpslmrpfltshevfelgwgdperraewvrqdeagrrel
    lekmagvmtvrgsdlgatvhqlgidwhmdafdvvrvlegllqdsgrdtsgtveeiltayp
    gllideerwrrvyfkagsspgvmmfcwllqdhagisyvlvlrqsadeqrligdglflrgi
    gakiieaeakllssgerrgagtaaagddrasageaarr
    

    Sequence, based on observed residues (ATOM records):
    >2xf3B (B:)
    vptpaeaalaaqtalaaddspmgdaarwamglltssglprpedvaarfiptfaaagnfae
    tvrewrskgpftvrayhpvahkgwvvlsapagvryilsltldssgliriltlkpetvipd
    mvtwndveetlhtpgvqhsvyavrltpdghevlhasaperpmptgsayklylmralvaei
    ekgtvgwdeiltltpelrslptgdmqdlpdgtrvtvretahkmialsdntgadlvadrlg
    revverslaaaghhdpslmrpfltshevfelgwgdperraewvrqdeagrrellekmagv
    mtvrgsdlgatvhqlgidwhmdafdvvrvlegllqdsgrdtsgtveeiltaypgllidee
    rwrrvyfkagsspgvmmfcwllqdhagisyvlvlrqsadeqrligdglflrgigakiiea
    eakllssg