PDB entry 2xf0

View 2xf0 on RCSB PDB site
Description: crystal structure of checkpoint kinase 1 (chk1) in complex with inhibitors
Class: transferase
Keywords: transferase, DNA repair, cell cycle
Deposited on 2010-05-19, released 2010-06-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2045
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xf0a_
  • Heterogens: 4UB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xf0A (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xf0A (A:)
    pfvedwdlvqtlgevqlavnrvteeavavkivdnikkeicinkmlnhenvvkfyghrrei
    qylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenllld
    erdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgivlt
    amlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsaritipdi
    kkdrwynkplk