PDB entry 2xez

View 2xez on RCSB PDB site
Description: Crystal structure of checkpoint kinase 1 (Chk1) in complex with inhibitors
Class: transferase
Keywords: transferase, DNA repair, cell cycle
Deposited on 2010-05-19, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xeza_
  • Heterogens: XEZ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xezA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xezA (A:)
    edwdlvqtlgevqlavnrvteeavavkivdmnikkeicinkmlnhenvvkfyghrreiqy
    lfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenlllder
    dnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgivltam
    lagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsaritipdikk
    drwynkplk