PDB entry 2xeu

View 2xeu on RCSB PDB site
Description: ring domain
Deposited on 2010-05-18, released 2010-07-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78317 (3-63)
      • expression tag (0-2)
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xeuA (A:)
gamvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkkinhkryh
piyi