PDB entry 2xet

View 2xet on RCSB PDB site
Description: conserved hydrophobic clusters on the surface of the caf1a usher c-terminal domain are important for f1 antigen assembly
Deposited on 2010-05-17, released 2010-09-22
The last revision was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1678
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F1 capsule-anchoring protein
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: F1 capsule-anchoring protein
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xetA (A:)
ggrlflhlkrsdnkpvpfgsivtiegqssssgivgdnsgvyltglpkkskilvkwgrdkn
qscssnvvlpektdisgayrlsttcilnn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xetB (B:)
ggrlflhlkrsdnkpvpfgsivtiegqssssgivgdnsgvyltglpkkskilvkwgrdkn
qscssnvvlpektdisgayrlsttcilnn

    Sequence, based on observed residues (ATOM records):
    >2xetB (B:)
grlflhlkrsdnkpvpfgsivtiegqssssgivgdnsgvyltglpkkskilvkwgrdknq
scssnvvlpektdisgayrlsttcilnn