PDB entry 2xem

View 2xem on RCSB PDB site
Description: induced-fit and allosteric effects upon polyene binding revealed by crystal structures of the dynemicin thioesterase
Class: biosynthetic protein
Keywords: biosynthetic protein, polyketide biosynthesis, enediyne antitumor agent, thioesterase
Deposited on 2010-05-17, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1627
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dyne7
    Species: MICROMONOSPORA CHERSINA [TaxId:47854]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HI7 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d2xema1, d2xema2
  • Chain 'B':
    Compound: dyne7
    Species: MICROMONOSPORA CHERSINA [TaxId:47854]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xemb_
  • Chain 'C':
    Compound: dyne7
    Species: MICROMONOSPORA CHERSINA [TaxId:47854]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xemc_
  • Chain 'D':
    Compound: dyne7
    Species: MICROMONOSPORA CHERSINA [TaxId:47854]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HI7 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d2xemd1, d2xemd2
  • Heterogens: SSV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xemA (A:)
    hhhhhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladgl
    alvtvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtva
    cmrraghglepvevpaelrralsryavvar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xemA (A:)
    hhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalv
    tvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmr
    raghglepvevpaelrralsryavv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xemB (B:)
    hhhhhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladgl
    alvtvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtva
    cmrraghglepvevpaelrralsryavvar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xemB (B:)
    dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch
    adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg
    lepvevpaelrralsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xemC (C:)
    hhhhhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladgl
    alvtvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtva
    cmrraghglepvevpaelrralsryavvar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xemC (C:)
    dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch
    adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg
    lepvevpaelrralsryav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xemD (D:)
    hhhhhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladgl
    alvtvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtva
    cmrraghglepvevpaelrralsryavvar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xemD (D:)
    hhhmpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalv
    tvdchadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmr
    raghglepvevpaelrralsryavva