PDB entry 2xdw

View 2xdw on RCSB PDB site
Description: Inhibition of Prolyl Oligopeptidase with a Synthetic Unnatural Dipeptide
Class: hydrolase
Keywords: alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, inhibitor
Deposited on 2010-05-09, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xdwa1, d2xdwa2
  • Chain 'P':
    Compound: synthetic peptide phq-pro-ycp
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XDW (0-2)
  • Heterogens: TAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xdwA (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip
    

  • Chain 'P':
    No sequence available.