PDB entry 2xdt

View 2xdt on RCSB PDB site
Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
Class: hydrolase
Keywords: glycoprotein, metal-binding, metalloprotease, protease, hydrolase, adaptive immunity
Deposited on 2010-05-07, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.15211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xdta1, d2xdta2, d2xdta3, d2xdta4
  • Heterogens: NAG, ZN, K, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xdtA (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
    tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
    tvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyalda
    avtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskl
    gitmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcf
    damevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqyl
    qkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwt
    lqkgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktk
    tdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafq
    lvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflir
    llrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpv
    dvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgd
    kiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstr
    trleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xdtA (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkglseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
    kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
    gliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtl
    lefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitm
    tvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdame
    vdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhs
    ykntknedlwdsmasigvdvktmmntwtlqkgfplititvrgrnvhmkqehymkgdtgyl
    whvpltfitsksdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltg
    llkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelip
    myklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqp
    cvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqie
    falcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvq
    kfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwm
    dknfdkirvwlqsekler