PDB entry 2xdh

View 2xdh on RCSB PDB site
Description: non-cellulosomal cohesin from the hyperthermophilic archaeon archaeoglobus fulgidus
Deposited on 2010-05-02, released 2010-05-26
The last revision was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.1931
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cohesin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30295 (1-156)
      • expression tag (0)
      • expression tag (157-162)
      • conflict (61)
  • Heterogens: CL, MG, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xdhA (A:)
    akttiiagsaeapqgsdiqvpvkienadkvgsinlilsypnvlevedvlqgsltqnslfd
    yqvegnqikvgiadsngisgdgslfyvkfrvtgnekaeqaenvkgklrglgqqlseitlr
    nshaltlqgieiydidgnsvkvatingtfrivsqeeahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2xdhA (A:)
    akttiiagsaeapqgsdiqvpvkienadkvgsinlilsypnvlevedvlqgsltqnslfd
    yqvegnqikvgiadsngisgdgslfyvkfrvttlrnshaltlqgieiydidgnsvkvati
    ngtfrivsqeeahhhhhh