PDB entry 2xd2

View 2xd2 on RCSB PDB site
Description: the crystal structure of malx from streptococcus pneumoniae
Class: sugar binding protein
Keywords: solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport, membrane protein
Deposited on 2010-04-28, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21885
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose/maltodextrin-binding protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59213
      • conflict (83)
      • conflict (409)
    Domains in SCOPe 2.07: d2xd2a_
  • Chain 'B':
    Compound: maltose/maltodextrin-binding protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59213
      • conflict (83)
      • conflict (409)
    Domains in SCOPe 2.07: d2xd2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xd2A (A:)
    mgsshhhhhhssglvprgshmasdkpadsgssevkeltvyvdegyksyieevakayekea
    gvkvtlktgdalggldklsldnqngnvpdvmmapydrvgslgsdgqlsevklsdgaktdd
    ttkslvtaangkvygapavieslvmyynkdlvkdapktfadlenlakdskyafagedgkt
    tafladwtnfyytygllagngayvfgqngkdakdiglandgsivginyakswyekwpkgm
    qdtegagnliqtqfqegktaaiidgpwkaqafkdakvnygvatiptlpngkeyaafgggk
    awvipqavknleasqkfvdflvateqqkvlydktneipantearsyaegkndelttavik
    qfkntqplpnisqmsavwdpaknmlfdavsgqkdaktaandavtliketlkqkfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xd2A (A:)
    keltvyvdegyksyieevakayekeagvkvtlktgdalggldklsldnqngnvpdvmmap
    ydrvgslgsdgqlsevklsdgaktddttkslvtaangkvygapavieslvmyynkdlvkd
    apktfadlenlakdskyafagedgkttafladwtnfyytygllagngayvfgqngkdakd
    iglandgsivginyakswyekwpkgmqdtegagnliqtqfqegktaaiidgpwkaqafkd
    akvnygvatiptlpngkeyaafgggkawvipqavknleasqkfvdflvateqqkvlydkt
    neipantearsyaegkndelttavikqfkntqplpnisqmsavwdpaknmlfdavsgqkd
    aktaandavtliketlkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xd2B (B:)
    mgsshhhhhhssglvprgshmasdkpadsgssevkeltvyvdegyksyieevakayekea
    gvkvtlktgdalggldklsldnqngnvpdvmmapydrvgslgsdgqlsevklsdgaktdd
    ttkslvtaangkvygapavieslvmyynkdlvkdapktfadlenlakdskyafagedgkt
    tafladwtnfyytygllagngayvfgqngkdakdiglandgsivginyakswyekwpkgm
    qdtegagnliqtqfqegktaaiidgpwkaqafkdakvnygvatiptlpngkeyaafgggk
    awvipqavknleasqkfvdflvateqqkvlydktneipantearsyaegkndelttavik
    qfkntqplpnisqmsavwdpaknmlfdavsgqkdaktaandavtliketlkqkfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xd2B (B:)
    eltvyvdegyksyieevakayekeagvkvtlktgdalggldklsldnqngnvpdvmmapy
    drvgslgsdgqlsevklsdgaktddttkslvtaangkvygapavieslvmyynkdlvkda
    pktfadlenlakdskyafagedgkttafladwtnfyytygllagngayvfgqngkdakdi
    glandgsivginyakswyekwpkgmqdtegagnliqtqfqegktaaiidgpwkaqafkda
    kvnygvatiptlpngkeyaafgggkawvipqavknleasqkfvdflvateqqkvlydktn
    eipantearsyaegkndelttavikqfkntqplpnisqmsavwdpaknmlfdavsgqkda
    ktaandavtliketl