PDB entry 2xcm

View 2xcm on RCSB PDB site
Description: complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Class: chaperone/protein binding
Keywords: chaperone-protein binding complex, stress response
Deposited on 2010-04-23, released 2010-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic heat shock protein 90
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7XJ80 (4-212)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2xcma1, d2xcma2
  • Chain 'B':
    Compound: cytosolic heat shock protein 90
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7XJ80 (4-212)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2xcmb1, d2xcmb2
  • Chain 'C':
    Compound: sgt1-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcmc_
  • Chain 'D':
    Compound: sgt1-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcmd_
  • Chain 'E':
    Compound: rar1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FLI9 (1-73)
      • expression tag (0)
  • Chain 'F':
    Compound: rar1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FLI9 (1-73)
      • expression tag (0)
  • Heterogens: ADP, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xcmA (A:)
    hhaaatetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdksk
    ldaqpelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvs
    migqfgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvl
    ylkddqmeyleerrikdlvkkhsefisypislwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcmA (A:)
    hhaaatetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdksk
    ldaqpelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvs
    migqfgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvl
    ylkddqmeyleerrikdlvkkhsefisypislw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xcmB (B:)
    hhaaatetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdksk
    ldaqpelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvs
    migqfgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvl
    ylkddqmeyleerrikdlvkkhsefisypislwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcmB (B:)
    hhaaatetetfafqaeinqllsliintfysnkeiflrelisnssdaldkirfesltdksk
    ldaqpelfihiipdkatstltivdsgigmtksdlvnnlgtiarsgtkefmealaagadvs
    migqfgvgfysaylvaervvvttkhnddeqyvwesqaggsftvtrdtsgeqlgrgtkmvl
    ylkddqmeyleerrikdlvkkhsefisypislw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xcmC (C:)
    akyrheyyqkpeevvvtvfakgipkqnvnidfgeqilsvvievpgedayylqprlfgkii
    pdkckyevlstkieiclakadiitwaslehgk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xcmD (D:)
    akyrheyyqkpeevvvtvfakgipkqnvnidfgeqilsvvievpgedayylqprlfgkii
    pdkckyevlstkieiclakadiitwaslehgk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.