PDB entry 2xck

View 2xck on RCSB PDB site
Description: crystal structure of pdk1 in complex with a pyrazoloquinazoline inhibitor
Class: transferase
Keywords: pi3-kinase signalling, transferase, ATP-binding, serine/threonine-protein kinase
Deposited on 2010-04-23, released 2010-07-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19495
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530 (Start-308)
      • conflict (45)
    Domains in SCOPe 2.05: d2xcka_
  • Heterogens: MH4, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xckA (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfsttvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xckA (A:)
    kkrpedfkfgkilgegsfsttvlarelatsreyaikilekrhiikenkvpyvtrerdvms
    rldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
    lhgkgiihrdlkpenillnedmhiqitdfgtakvlsnsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppklt