PDB entry 2xce

View 2xce on RCSB PDB site
Description: Structure of YncF in complex with dUpNHpp
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-04-22, released 2010-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.153
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcea_
  • Chain 'B':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xceb_
  • Chain 'C':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcec_
  • Chain 'D':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xced_
  • Chain 'E':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcee_
  • Chain 'F':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2xcef_
  • Heterogens: DUP, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xceA (A:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceA (A:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xceB (B:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceB (B:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xceC (C:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceC (C:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xceD (D:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceD (D:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xceE (E:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceE (E:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xceF (F:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xceF (F:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl