PDB entry 2xcd

View 2xcd on RCSB PDB site
Description: Structure of YncF,the genomic dUTPase from Bacillus subtilis
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-04-22, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcda_
  • Chain 'B':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcdb_
  • Chain 'C':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcdc_
  • Chain 'D':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcdd_
  • Chain 'E':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcde_
  • Chain 'F':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xcdf_
  • Heterogens: MG, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xcdA (A:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdA (A:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xcdB (B:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdB (B:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xcdC (C:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdC (C:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xcdD (D:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdD (D:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xcdE (E:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdE (E:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xcdF (F:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xcdF (F:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehl