PDB entry 2xc7

View 2xc7 on RCSB PDB site
Description: solution structure of phax-rbd in complex with ssrna
Deposited on 2010-04-18, released 2010-04-28
The last revision was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylated adapter RNA export protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H814 (3-103)
      • expression tag (0-2)
  • Chain 'P':
    Compound: 5'-(ap*up*cp*gp)-3'

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xc7A (A:)
gamaedsqekvadeisfrlqepkkdliarvvriignkkaiellmetaeveqngglfimng
srrrtpggvflnllkntpsiseeqikdifyienqkeyenkkaar

  • Chain 'P':
    No sequence available.