PDB entry 2xc3

View 2xc3 on RCSB PDB site
Description: x-ray structure of mycobacterium tuberculosis cyp125 bound to the reverse type I inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, metal-binding
Deposited on 2010-04-16, released 2010-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.12487
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 125
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63709
      • engineered mutation (419)
    Domains in SCOPe 2.03: d2xc3a_
  • Heterogens: HEM, RT8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xc3A (A:)
    mhhhhhhmpspnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdgg
    fwaitklndvkeisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrk
    iisrgftpravgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqed
    rgklfhwsnemtgnedpeyahidpkassaeligyamkmaeekaknpaddivtqliqadid
    geklsddefgffvvmlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrw
    atpvtafqrtalrdyelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgf
    ggtgahyciganlarmtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytgrl
    pvah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xc3A (A:)
    spnlppgfdftdpaiyaerlpvaefaelrsaapiwwngqdpgkgggfhdggfwaitklnd
    vkeisrhsdvfssyengviprfkndiaredievqrfvmlnmdaphhtrlrkiisrgftpr
    avgrlhdelqeraqkiaaeaaaagsgdfveqvscelplqaiagllgvpqedrgklfhwsn
    emtgnedpeyahidpkassaeligyamkmaeekadivtqliqadidgeklsddefgffvv
    mlavagnettrnsitqgmmafaehpdqwelykkvrpetaadeivrwatpvtafqrtalrd
    yelsgvqikkgqrvvmfyrsanfdeevfqdpftfnilrnpnphvgfggtgahyciganla
    rmtinlifnavadhmpdlkpisaperlrsgwlngikhwqvdytgrlpva