PDB entry 2xbi

View 2xbi on RCSB PDB site
Description: Crystal structure of Schistosoma mansoni Thioredoxin at 1.6 Angstrom
Class: oxidoreductase
Keywords: oxidoreductase, protein disulfide reductase
Deposited on 2010-04-12, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.20136
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Schistosoma mansoni [TaxId:6183]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8T9N5 (2-107)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2xbia1, d2xbia2
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xbiA (A:)
  gsmsklielkqdgdleslleqhknklvvvdffatwcgpcktiaplfkelsekydaifvkv
  dvdkleetarkynisamptfiaikngekvgdvvgasiakvedmikkfi