PDB entry 2xbi

View 2xbi on RCSB PDB site
Description: Crystal structure of Schistosoma mansoni Thioredoxin at 1.6 Angstrom
Class: oxidoreductase
Keywords: oxidoreductase, protein disulfide reductase
Deposited on 2010-04-12, released 2010-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.20136
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T9N5 (2-107)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2xbia1, d2xbia2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xbiA (A:)
    gsmsklielkqdgdleslleqhknklvvvdffatwcgpcktiaplfkelsekydaifvkv
    dvdkleetarkynisamptfiaikngekvgdvvgasiakvedmikkfi