PDB entry 2xai

View 2xai on RCSB PDB site
Description: Crystal structure of ankyrin repeat and SOCS box-containing protein 9 (ASB9) in complex with elonginB and elonginC
Class: transcription
Keywords: transcription, transcription regulation, autoantibody
Deposited on 2010-03-31, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.2376
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xaib_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xaie_
  • Chain 'F':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xaif_
  • Heterogens: EDO, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xaiB (B:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xaiB (B:)
    yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei
    pefpiapeialellmaanfldc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xaiE (E:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xaiE (E:)
    yvklissdghefivkrehaltsgtikamlevnfreipshvlskvcmyftykvrytnseip
    efpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xaiF (F:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xaiF (F:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq