PDB entry 2xa8

View 2xa8 on RCSB PDB site
Description: crystal structure of the fab domain of omalizumab at 2.41a
Class: immune system
Keywords: xolair, allergy, immune system
Deposited on 2010-03-30, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: omalizumab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2XA8 (0-218)
• Chain 'L':
  Compound: omalizumab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2XA8 (0-217)
  Domains in SCOPe 2.06: d2xa8l1, d2xa8l2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xa8L (L:)
  diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
  gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkveikrtvaapsvf
  ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
  stltlskadyekhkvyacevthqglsspvtksfnrgec