PDB entry 2xa6

View 2xa6 on RCSB PDB site
Description: structural basis for homodimerization of the src-associated during mitosis, 68 kd protein (sam68) qua1 domain
Deposited on 2010-03-29, released 2010-07-07
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kh domain-containing,RNA-binding,signal transduction-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: kh domain-containing,RNA-binding,signal transduction-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xa6A (A:)
gamepenkylpelmaekdsldpsfthamqlltaeiekiqkg

    Sequence, based on observed residues (ATOM records):
    >2xa6A (A:)
penkylpelmaekdsldpsfthamqlltaeiekiqkg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xa6B (B:)
gamepenkylpelmaekdsldpsfthamqlltaeiekiqkg

    Sequence, based on observed residues (ATOM records):
    >2xa6B (B:)
penkylpelmaekdsldpsfthamqlltaeiekiqkg