PDB entry 2xa3

View 2xa3 on RCSB PDB site
Description: crystal structure of the broadly neutralizing llama vhh d7 and its mode of hiv-1 gp120 interaction
Class: immune system
Keywords: immune system
Deposited on 2010-03-29, released 2010-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: llama heavy chain antibody d7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XA3 (0-126)
    Domains in SCOPe 2.01: d2xa3a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xa3A (A:)
    avqlqesggglvqaggslrlsctvsartssshdmgwfrqapgkerefvaaiswsggttny
    vdsvkgrfdiskdnaknavylqmnslkpedtavyycaakwrplrysdnpsnsdynywgqg
    tqvtvss