PDB entry 2xa3

View 2xa3 on RCSB PDB site
Description: crystal structure of the broadly neutralizing llama VHH D7 and its mode of HIV-1 gp120 interaction
Class: immune system
Keywords: immune system
Deposited on 2010-03-29, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: llama heavy chain antibody d7
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 2XA3 (0-126)
  Domains in SCOPe 2.08: d2xa3a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xa3A (A:)
  avqlqesggglvqaggslrlsctvsartssshdmgwfrqapgkerefvaaiswsggttny
  vdsvkgrfdiskdnaknavylqmnslkpedtavyycaakwrplrysdnpsnsdynywgqg
  tqvtvss