PDB entry 2x9z

View 2x9z on RCSB PDB site
Description: structure of the pilus backbone (rrgb) from streptococcus pneumoniae
Deposited on 2010-03-25, released 2010-06-30
The last revision was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.152
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell wall surface anchor family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97SC2 (0-261)
      • engineered mutation (187)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2x9zA (A:)
akpkidkdfkgkanpdtprvdkdtpvnhqvgdvveyeivtkipalanyatanwsdrmteg
lafnkgtvkvtvddvaleagdyaltevatgfdlkltdaglakvndqnaektvkitysatl
ndkaivevpesndvtfnygnnpdhgntpkpnkpnengdltltktwvdatgapipagaeat
fdlvnaqagkvvqtvtlttdkntvtvngldknteykfversikgysadyqeittageiav
knwkdenpkpldptepkvvtyg