PDB entry 2x9t

View 2x9t on RCSB PDB site
Description: Structure of the 70S ribosome bound to Release Factor 2 and a substrate analog provides insights into catalysis of peptide release
Class: ribosome
Keywords: ribosomal protein, ribonucleoprotein, tRNA-binding, rRNA-binding, metal-binding, ribosome, zinc-finger, translation
Deposited on 2010-03-24, released 2010-05-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.223
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 30s ribosomal protein s14 type z
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 30S ribosomal protein Thx
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: e-site tRNA phe or p-site tRNA phe (unmodified bases)
    Species: Escherichia coli [TaxId:83333]
  • Chain 'W':
    Compound: e-site tRNA phe or p-site tRNA phe (unmodified bases)
    Species: Escherichia coli [TaxId:83333]
  • Chain 'X':
    Compound: mRNA
  • Chain 'Y':
    Compound: Peptide chain release factor 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X9T (0-11)
    • Uniprot Q5SM01 (12-350)
    Domains in SCOPe 2.05: d2x9ty_
  • Heterogens: MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x9tY (Y:)
    laqrleglrgyldipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrsl
    esdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgag
    gteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeag
    vhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvntt
    dsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpi
    ewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr