PDB entry 2x9r

View 2x9r on RCSB PDB site
Description: Structure of the 70S ribosome bound to Release factor 2 and a substrate analog provides insights into catalysis of peptide release
Class: ribosome
Keywords: ribosomal protein, ribonucleoprotein, tRNA-binding, rRNA-binding, metal-binding, ribosome, zinc-finger, translation
Deposited on 2010-03-24, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.223
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16s rRNA
  Species: Thermus thermophilus [TaxId:300852]
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80371
• Chain 'C':
  Compound: 30S ribosomal protein S3
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80372
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80373 (Start-208)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ5
• Chain 'F':
  Compound: 30S ribosomal protein S6
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLP8 (0-100)
• Chain 'G':
  Compound: 30S ribosomal protein S7
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17291 (Start-155)
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ2 (0-137)
• Chain 'I':
  Compound: 30S ribosomal protein S9
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62669 (Start-127)
• Chain 'J':
  Compound: 30S ribosomal protein S10
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHN7
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80376 (Start-128)
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHN3
• Chain 'M':
  Compound: 30S ribosomal protein S13
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80377 (Start-125)
• Chain 'N':
  Compound: 30s ribosomal protein s14 type z
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ1 (Start-60)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJ76 (Start-88)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJH3 (0-End)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHP7
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLQ0 (Start-87)
• Chain 'S':
  Compound: 30S ribosomal protein S19
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHP2
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80380 (Start-105)
• Chain 'U':
  Compound: 30S ribosomal protein Thx
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SIH3
• Chain 'V':
  Compound: e-site tRNA phe or p-site tRNA phe (unmodified bases)
  Species: Escherichia coli [TaxId:83333]
  
• Chain 'W':
  Compound: e-site tRNA phe or p-site tRNA phe (unmodified bases)
  Species: Escherichia coli [TaxId:83333]
  
• Chain 'X':
  Compound: mRNA
  
• Chain 'Y':
  Compound: Peptide chain release factor 2
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • PDB 2X9R (0-11)
  • Uniprot Q5SM01 (12-350)
  Domains in SCOPe 2.06: d2x9ry1, d2x9ry2
• Heterogens: MG, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2x9rY (Y:)
  laqrleglrgyldipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrsl
  esdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgag
  gteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeag
  vhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvntt
  dsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpi
  ewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr