PDB entry 2x9p

View 2x9p on RCSB PDB site
Description: x-ray structure of the substrate-free cytochrome p450 pimd -a polyene macrolide antibiotic pimaricin epoxidase
Class: oxidoreductase
Keywords: epoxidation, oxidoreductase
Deposited on 2010-03-23, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1884
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pimd protein
    Species: STREPTOMYCES NATALENSIS [TaxId:68242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x9pa_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x9pA (A:)
    mrgshhhhhhgshdlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhae
    lkqllhderigrthpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarr
    vlemqpkveeaadtlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttlla
    giaklddregavraqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllf
    agldsvasimdngvvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryased
    mefggvtiragdlvlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplar
    lelrtmftklftrlpelrpelpveqlrlkegqlsggfaelrvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x9pA (A:)
    shdlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhaelkqllhderig
    rthpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarrvlemqpkveea
    adtlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttllagiaklddrega
    vraqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllfagldsvasimd
    ngvvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryasedmefggvtirag
    dlvlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplarlelrtmftklf
    trlpelrpelpveqlrlfaelrvvw