PDB entry 2x9d

View 2x9d on RCSB PDB site
Description: Tet repressor (class D) in complex with iso-7-chlortetracycline
Class: transcription
Keywords: transcription, gene regulation, hth-motif, DNA-binding protein, antibiotic resistance
Deposited on 2010-03-15, released 2011-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.23826
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • engineered mutation (0)
    Domains in SCOPe 2.06: d2x9da1, d2x9da2
  • Heterogens: ITC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x9dA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x9dA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtnlppllrealqimdsddgeqaflhglesl
    irgfevqltallqiv